PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019072.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 906aa    MW: 103098 Da    PI: 8.1141
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019072.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA42.77.6e-14630666135
         GATA   1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +Cg ++  T+++Rrgp+g +tLCnaCG+ ++k ++
  Aco019072.1 630 CLHCGISSkfTSHMRRGPEGRRTLCNACGIAWKKGKQ 666
                  99***99999************************987 PP

2FAR180.14.1e-25700785188
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                  +fYn+YA  vGFsvrk    ks  ++ + +rt+vCs+eg+r+++k + ++ +r+r+etr+gC a+l+ k++++g+++vt++  +HnH+
  Aco019072.1 700 EFYNRYAGVVGFSVRKGWLDKS-SDNVTRSRTLVCSREGFRKDKKGA-KEVKRPRPETRIGCPARLTFKLTQNGTYKVTEFIADHNHQ 785
                  6********************9.566699**************9999.999************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513758.33188124IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.785125159IPR002885Pentatricopeptide repeat
PfamPF128543.1E-6195223IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.383196226IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.4E-5199226IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.038227261IPR002885Pentatricopeptide repeat
PfamPF015357.6E-4229259IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.0E-5229262IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.294262296IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.024297327IPR002885Pentatricopeptide repeat
PfamPF015350.015302327IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.898328362IPR002885Pentatricopeptide repeat
PfamPF015350.011331358IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.566363393IPR002885Pentatricopeptide repeat
PfamPF015351.2370391IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.259399429IPR002885Pentatricopeptide repeat
PfamPF015350.33402421IPR002885Pentatricopeptide repeat
PfamPF144323.8E-40478602IPR032867DYW domain
SMARTSM004011.6E-8624686IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.09E-9626676No hitNo description
Gene3DG3DSA:3.30.50.101.7E-11628667IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.33E-9629669No hitNo description
PfamPF003202.3E-11630666IPR000679Zinc finger, GATA-type
PROSITE patternPS003440630657IPR000679Zinc finger, GATA-type
PfamPF031012.2E-22700785IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009451Biological ProcessRNA modification
GO:0009507Cellular Componentchloroplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MVLTSNPLVC LSSSQSFPFP SPSPHSIFPY LKTTETLRDL KPLHALAIKT SQIKDPLVAA  60
EVLRCVALSS DRNLHYARLV FGEMLQPNCF SWNTIIRALS ESEGDALEAI ILFLKMLHSD  120
NAQPNQYTFP SVLKACARIE AIDIGKQIHN QTIKFGLFSD GFVLTNLVRL YTLCGFMEDA  180
IRLVKTSSLS PTSEANVVLH NILIDGYFRL GMVHHANRIF NQMPKKSMIS WNEMIARFAQ  240
IGCFREAVEV FRAMQLEGVK PNYVSLVSVL PAISRLGALE LGKWVHLYIN KNGILVDDVL  300
GSTLVDMYSK CGNIDKAIQV FEGLPKKNST TWSALISGLA MHGRARVALN HFAMMEKAKV  360
IPSDVVFIGI LNACSHAGLV EDGRLFFDRM VNGYKIRPRI EHYTCMVDML GRAGLLNEAE  420
ESILNMPIKP DEAIYKSLLA ACRIHGNQSA WLTDFWSNWG AMAEVRLKMK EQDIKKDPGC  480
SWITIDGNIH EFIVEDNAHP RKTEIYEMLE EIANKLKIAG YVSDTTQVLL NIDEEEKEKM  540
IYYHSEKIAI AFGLISTREG MTLQVVKNLR VCGDCHSSIK LISKMYNRRI VLRDRNRFHH  600
FENGMSYAED QDEDAHPNNG DDGLEDPLRC LHCGISSKFT SHMRRGPEGR RTLCNACGIA  660
WKKGKQRKII DYDAPVQDLE NSKMVPEIDM EFENEDKAYE FYNRYAGVVG FSVRKGWLDK  720
SSDNVTRSRT LVCSREGFRK DKKGAKEVKR PRPETRIGCP ARLTFKLTQN GTYKVTEFIA  780
DHNHQPAPPS AMHMLRSQRV TTEVHSSEYY ERVVDEHRYA ELQADFHASQ SFPRIPPSKM  840
LRQAANMYTP AVFEMFRKEF EIFMDCMLYS CGEIGTIAEY KLLHRNIRLL MHNNGHFMVA  900
VSWVRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9h_A1e-346544318413pentatricopeptide repeat protein dPPR-U8G2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1748752KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391221.10.0PREDICTED: pentatricopeptide repeat-containing protein At5g48910
SwissprotQ9FI800.0PP425_ARATH; Pentatricopeptide repeat-containing protein At5g48910
TrEMBLA0A061FRW30.0A0A061FRW3_THECC; Pentatricopeptide repeat (PPR) superfamily protein
STRINGPOPTR_0014s18910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-20FAR1-related sequence 5